Lineage for d1ery__ (1ery -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1937Fold a.10: Protozoan pheromone proteins [47013] (1 superfamily)
  4. 1938Superfamily a.10.1: Protozoan pheromone proteins [47014] (1 family) (S)
  5. 1939Family a.10.1.1: Protozoan pheromone proteins [47015] (5 proteins)
  6. 1947Protein ER-11 [47022] (1 species)
  7. 1948Species Euplotes raikovi [TaxId:5938] [47023] (1 PDB entry)
  8. 1949Domain d1ery__: 1ery - [16364]

Details for d1ery__

PDB Entry: 1ery (more details)

PDB Description: pheromone er-11, nmr

SCOP Domain Sequences for d1ery__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ery__ a.10.1.1 (-) ER-11 {Euplotes raikovi}
decanaaaqcsitlcnlycgplieiceltvmqnceppfs

SCOP Domain Coordinates for d1ery__:

Click to download the PDB-style file with coordinates for d1ery__.
(The format of our PDB-style files is described here.)

Timeline for d1ery__: