Lineage for d1erya_ (1ery A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309686Fold a.10: Protozoan pheromone-like [47013] (2 superfamilies)
    3 helices; bundle, closed, left-handed twist, up-and-down
  4. 2309687Superfamily a.10.1: Protozoan pheromone proteins [47014] (1 family) (S)
    automatically mapped to Pfam PF06360
  5. 2309688Family a.10.1.1: Protozoan pheromone proteins [47015] (5 proteins)
  6. 2309696Protein ER-11 [47022] (1 species)
  7. 2309697Species Euplotes raikovi [TaxId:5938] [47023] (1 PDB entry)
  8. 2309698Domain d1erya_: 1ery A: [16364]

Details for d1erya_

PDB Entry: 1ery (more details)

PDB Description: pheromone er-11, nmr
PDB Compounds: (A:) pheromone er-11

SCOPe Domain Sequences for d1erya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1erya_ a.10.1.1 (A:) ER-11 {Euplotes raikovi [TaxId: 5938]}
decanaaaqcsitlcnlycgplieiceltvmqnceppfs

SCOPe Domain Coordinates for d1erya_:

Click to download the PDB-style file with coordinates for d1erya_.
(The format of our PDB-style files is described here.)

Timeline for d1erya_: