Lineage for d2dhtb_ (2dht B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138632Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2138633Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2138965Family c.77.1.0: automated matches [191423] (1 protein)
    not a true family
  6. 2138966Protein automated matches [190603] (16 species)
    not a true protein
  7. 2139027Species Sulfolobus tokodaii [TaxId:273063] [187622] (3 PDB entries)
  8. 2139033Domain d2dhtb_: 2dht B: [163639]
    automated match to d1ai2a_

Details for d2dhtb_

PDB Entry: 2dht (more details), 2.5 Å

PDB Description: Crystal structure of isocitrate dehydrogenase from Sulfolobus tokodaii strain7
PDB Compounds: (B:) 409aa long hypothetical NADP-dependent isocitrate dehydrogenase

SCOPe Domain Sequences for d2dhtb_:

Sequence, based on SEQRES records: (download)

>d2dhtb_ c.77.1.0 (B:) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
mlykepedgekikfdkgkwivpnkpvilyiegdgigpeitnaaikvinkaveraygssre
ikwlevyagekaeklvndrfpketqemllkyrvvlkgpletpigkgwksvnvairlmldl
yanirpvkyieglesplkhpekvdmiifrentddlyrgieypfnseeakkirdflrkelk
veieddtgigikvmskyktqritrlaiqyaiehkrkkvtimhkgnvmkytegafrewaye
valkeyrdfivteeeinqgkpdqgkiilndriadnmfqqiiirpeeydiilapnvngdyi
sdaagalignigmlgganigdeggmfeaihgtapkyagknvanptgiikagelmlrwmgw
neaadliekainmairdkkvtqdiarfmgvkalgtkeyadelikimdti

Sequence, based on observed residues (ATOM records): (download)

>d2dhtb_ c.77.1.0 (B:) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
mlykepedgekikfdkgkwivpnkpvilyiegdgigpeitnaaikvinkaveraygssre
ikwlevyagekaeklvndrfpketqemllkyrvvlkgpletpsvnvairlmldlyanirp
vkyieglesplkhpekvdmiifrentddlyrgieypfnseeakkirdflrkelkveiedd
tgigikvmskyktqritrlaiqyaiehkrkkvtimhkgnvmkytegafrewayevalkey
rdfivteeeinqgkpdqgkiilndriadnmfqqiiirpeeydiilapnvngdyisdaaga
lignigmlgganigdeggmfeaihgtapkyagknvanptgiikagelmlrwmgwneaadl
iekainmairdkkvtqdiarfmgvkalgtkeyadelikimdti

SCOPe Domain Coordinates for d2dhtb_:

Click to download the PDB-style file with coordinates for d2dhtb_.
(The format of our PDB-style files is described here.)

Timeline for d2dhtb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2dhta_