![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
![]() | Protein automated matches [190453] (26 species) not a true protein |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [187367] (4 PDB entries) |
![]() | Domain d2dged_: 2dge D: [163630] automated match to d1c6sa_ complexed with hem, zn |
PDB Entry: 2dge (more details), 1.5 Å
SCOPe Domain Sequences for d2dged_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dged_ a.3.1.0 (D:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} qtldiqrgatlfnracigchdtggniiqpgatlftkdlerngvdteeeiyrvtyfgkgrm pgfgekctprgqctfgprlqdeeikllaefvkfqadqgwp
Timeline for d2dged_: