SCOPe 2.06: Domain d2dgeb_: 2dge B:

Lineage for d2dgeb_ (2dge B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.0: automated matches [191374] (1 protein)
   not a true family

6. Protein automated matches [190453] (22 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [187367] (4 PDB entries)

8. Domain d2dgeb_: 2dge B: [163628]
   automated match to d1c6sa_
   complexed with hem, zn

Details for d2dgeb_

PDB Entry: 2dge, 1.5 Å

PDB Description: Crystal structure of oxidized cytochrome C6A from Arabidopsis thaliana

PDB Compounds: (B:) cytochrome c6

SCOPe Domain Sequences for d2dgeb_:

Sequence; same for both SEQRES and ATOM records:

>d2dgeb_ a.3.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
qtldiqrgatlfnracigchdtggniiqpgatlftkdlerngvdteeeiyrvtyfgkgrm
pgfgekctprgqctfgprlqdeeikllaefvkfqadqgwptv

Timeline for d2dgeb_:

• d2dgeb_ first appeared in SCOPe 2.01
  
• d2dgeb_ appears in SCOPe 2.05
  
• d2dgeb_ appears in SCOPe 2.07
  
• d2dgeb_ appears in the current release, SCOPe 2.08