Lineage for d2dgea_ (2dge A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2691615Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 2691616Protein automated matches [190453] (26 species)
    not a true protein
  7. 2691757Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [187367] (4 PDB entries)
  8. 2691760Domain d2dgea_: 2dge A: [163627]
    automated match to d1c6sa_
    complexed with hem, zn

Details for d2dgea_

PDB Entry: 2dge (more details), 1.5 Å

PDB Description: Crystal structure of oxidized cytochrome C6A from Arabidopsis thaliana
PDB Compounds: (A:) cytochrome c6

SCOPe Domain Sequences for d2dgea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dgea_ a.3.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
qtldiqrgatlfnracigchdtggniiqpgatlftkdlerngvdteeeiyrvtyfgkgrm
pgfgekctprgqctfgprlqdeeikllaefvkfqadqgwptv

SCOPe Domain Coordinates for d2dgea_:

Click to download the PDB-style file with coordinates for d2dgea_.
(The format of our PDB-style files is described here.)

Timeline for d2dgea_: