Lineage for d2df5b_ (2df5 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140812Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2142222Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (2 families) (S)
  5. 2142223Family c.56.4.1: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53183] (2 proteins)
    automatically mapped to Pfam PF01470
  6. 2142275Protein automated matches [190601] (1 species)
    not a true protein
  7. 2142276Species Pyrococcus furiosus [TaxId:2261] [187619] (2 PDB entries)
  8. 2142282Domain d2df5b_: 2df5 B: [163620]
    automated match to d1iofa_

Details for d2df5b_

PDB Entry: 2df5 (more details), 2.3 Å

PDB Description: Crystal Structure of Pf-PCP(1-204)-C
PDB Compounds: (B:) Pyrrolidone-carboxylate peptidase

SCOPe Domain Sequences for d2df5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2df5b_ c.56.4.1 (B:) automated matches {Pyrococcus furiosus [TaxId: 2261]}
mkvlvtgfepfggekinpteriakdldgikigdaqvfgrvlpvvfgkakevlektleeik
pdiaihvglapgrsaisieriavnaidaripdnegkkiedepivpgaptayfstlpikki
mkklhergipayisnsaglylcnyvmylslhhsatkgypkmsgfihvpyipeqiidkigk
gqvppsmcyemeleavkvaievaltqdminkst

SCOPe Domain Coordinates for d2df5b_:

Click to download the PDB-style file with coordinates for d2df5b_.
(The format of our PDB-style files is described here.)

Timeline for d2df5b_: