SCOPe 2.05: Domain d2depb_: 2dep B:

Lineage for d2depb_ (2dep B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (72 species)
   not a true protein

7. Species Clostridium stercorarium [TaxId:1510] [187615] (1 PDB entry)

8. Domain d2depb_: 2dep B: [163618]
   automated match to d1hiza_

Details for d2depb_

PDB Entry: 2dep, 1.8 Å

PDB Description: crystal structure of xylanase b from clostridium stercorarium f9

PDB Compounds: (B:) Thermostable celloxylanase

SCOPe Domain Sequences for d2depb_:

Sequence; same for both SEQRES and ATOM records:

>d2depb_ c.1.8.0 (B:) automated matches {Clostridium stercorarium [TaxId: 1510]}
ipslaeafrdyfpigaaiepgyttgqiaelykkhvnmlvaenamkpaslqptegnfqwad
adrivqfakengmelrfhtlvwhnqtpdwffldkegkpmveetdpqkreenrklllqrle
nyiravvlrykddikswdvvneviepndpggmrnspwyqitgteyievafratreaggsd
iklyindyntddpvkrdilyelvknllekgvpidgvghqthidiynppveriiesikkfa
glgldniiteldmsiyswndrsdygdsipdyiltlqakryqelfdalkenkdivsavvfw
gisdkyswlngfpvkrtnapllfdrnfmpkpafwaivdp

Timeline for d2depb_:

• d2depb_ first appeared in SCOPe 2.01
  
• d2depb_ appears in SCOPe 2.04
  
• d2depb_ appears in SCOPe 2.06
  
• d2depb_ appears in the current release, SCOPe 2.08