Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
Protein automated matches [190526] (18 species) not a true protein |
Species Favia favus [TaxId:102203] [188529] (3 PDB entries) |
Domain d2ddcb_: 2ddc B: [163612] automated match to d1mova_ complexed with mg, na |
PDB Entry: 2ddc (more details), 1.55 Å
SCOPe Domain Sequences for d2ddcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ddcb_ d.22.1.0 (B:) automated matches {Favia favus [TaxId: 102203]} vsvitsemkievrmegavnghkfvitgkgsgqpfegiqnvdltvieggplpfafdiltta fhygnrvfvkypeeivdyfkqsfpegyswersmsyedggiclatnnitmkkdgsncfvne irfdgvnfpangpvmqrktvkwesstekmyvrdgvlkgdvnmalllqggghyrcdfrtty kakkvvqlpdyhfvdhlmeitshdkdynkvklyehakahsglprlak
Timeline for d2ddcb_: