SCOPe 2.05: Domain d2ddca_: 2ddc A:

Lineage for d2ddca_ (2ddc A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (20 species)
   not a true protein

7. Species Favia favus [TaxId:102203] [188529] (4 PDB entries)

8. Domain d2ddca_: 2ddc A: [163611]
   automated match to d1mova_
   complexed with mg, na

Details for d2ddca_

PDB Entry: 2ddc, 1.55 Å

PDB Description: unique behavior of a histidine responsible for an engineered green-to- red photoconversion process

PDB Compounds: (A:) photoconvertible fluorescent protein

SCOPe Domain Sequences for d2ddca_:

Sequence; same for both SEQRES and ATOM records:

>d2ddca_ d.22.1.0 (A:) automated matches {Favia favus [TaxId: 102203]}
vsvitsemkievrmegavnghkfvitgkgsgqpfegiqnvdltvieggplpfafdiltta
fhygnrvfvkypeeivdyfkqsfpegyswersmsyedggiclatnnitmkkdgsncfvne
irfdgvnfpangpvmqrktvkwesstekmyvrdgvlkgdvnmalllqggghyrcdfrtty
kakkvvqlpdyhfvdhlmeitshdkdynkvklyehakahsglprla

Timeline for d2ddca_:

• d2ddca_ first appeared in SCOPe 2.01
  
• d2ddca_ appears in SCOPe 2.04
  
• d2ddca_ appears in SCOPe 2.06
  
• d2ddca_ appears in the current release, SCOPe 2.08