SCOPe 2.08: Domain d2dc4a_: 2dc4 A:

Lineage for d2dc4a_ (2dc4 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.63: CYTH-like phosphatases [55153] (1 superfamily)
   duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it

4. Superfamily d.63.1: CYTH-like phosphatases [55154] (3 families)

5. Family d.63.1.2: CYTH domain [118007] (5 proteins)
   Pfam PF01928

6. Protein automated matches [190597] (3 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:53953] [187613] (1 PDB entry)

8. Domain d2dc4a_: 2dc4 A: [163609]
   automated match to d1yemb_
   complexed with cl

Details for d2dc4a_

PDB Entry: 2dc4, 1.65 Å

PDB Description: Structure of PH1012 protein from Pyrococcus Horikoshii OT3

PDB Compounds: (A:) 165aa long hypothetical protein

SCOPe Domain Sequences for d2dc4a_:

Sequence; same for both SEQRES and ATOM records:

>d2dc4a_ d.63.1.2 (A:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
meievkfrvnfedikrkieglgakffgieeqedvyfelpspkllrvrkinntgksyityk
eildkrneefyelefevqdpegaielfkrlgfkvqgvvkkrrwiyklnnvtfelnrveka
gdfldievitsnpeegkkiiwdvarrlglkeedvepklyielin

Timeline for d2dc4a_:

• d2dc4a_ first appeared in SCOPe 2.01
  
• d2dc4a_ appears in SCOPe 2.07