SCOPe 2.07: Domain d2dboa_: 2dbo A:

Lineage for d2dboa_ (2dbo A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.110: DTD-like [69499] (1 superfamily)
   beta(2)-(alpha-beta)2-beta(3); 3 layers, a/b/b; some topological similarity to the N-terminal domain of MinC

4. Superfamily c.110.1: DTD-like [69500] (3 families)
   active form is a dimer

5. Family c.110.1.0: automated matches [191422] (1 protein)
   not a true family

6. Protein automated matches [190596] (6 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:224324] [187612] (1 PDB entry)

8. Domain d2dboa_: 2dbo A: [163608]
   automated match to d1j7ga_

Details for d2dboa_

PDB Entry: 2dbo, 2.76 Å

PDB Description: Crystal structure of D-Tyr-tRNA(Tyr) deacylase from Aquifex aeolicus

PDB Compounds: (A:) D-tyrosyl-tRNA(Tyr) deacylase

SCOPe Domain Sequences for d2dboa_:

Sequence; same for both SEQRES and ATOM records:

>d2dboa_ c.110.1.0 (A:) automated matches {Aquifex aeolicus [TaxId: 224324]}
mraviqrvkkswvevdgkvvgsineglnvflgvrkgdteedieklvnkilnlrifederg
kfqysvldikgeilvvsqftlyanvkkgrrpsfeeaeepkrakelyekfvdkikesglkv
etgifgammdvfienwgpvtiiidsrei

Timeline for d2dboa_:

• d2dboa_ first appeared in SCOPe 2.01
  
• d2dboa_ appears in SCOPe 2.06
  
• d2dboa_ appears in the current release, SCOPe 2.08