Lineage for d2dboa_ (2dbo A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2528103Fold c.110: DTD-like [69499] (1 superfamily)
    beta(2)-(alpha-beta)2-beta(3); 3 layers, a/b/b; some topological similarity to the N-terminal domain of MinC
  4. 2528104Superfamily c.110.1: DTD-like [69500] (3 families) (S)
    active form is a dimer
  5. 2528151Family c.110.1.0: automated matches [191422] (1 protein)
    not a true family
  6. 2528152Protein automated matches [190596] (6 species)
    not a true protein
  7. 2528168Species Aquifex aeolicus [TaxId:224324] [187612] (1 PDB entry)
  8. 2528169Domain d2dboa_: 2dbo A: [163608]
    automated match to d1j7ga_

Details for d2dboa_

PDB Entry: 2dbo (more details), 2.76 Å

PDB Description: Crystal structure of D-Tyr-tRNA(Tyr) deacylase from Aquifex aeolicus
PDB Compounds: (A:) D-tyrosyl-tRNA(Tyr) deacylase

SCOPe Domain Sequences for d2dboa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dboa_ c.110.1.0 (A:) automated matches {Aquifex aeolicus [TaxId: 224324]}
mraviqrvkkswvevdgkvvgsineglnvflgvrkgdteedieklvnkilnlrifederg
kfqysvldikgeilvvsqftlyanvkkgrrpsfeeaeepkrakelyekfvdkikesglkv
etgifgammdvfienwgpvtiiidsrei

SCOPe Domain Coordinates for d2dboa_:

Click to download the PDB-style file with coordinates for d2dboa_.
(The format of our PDB-style files is described here.)

Timeline for d2dboa_: