SCOPe 2.05: Domain d2d7fl_: 2d7f L:

Lineage for d2d7fl_ (2d7f L:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein automated matches [190035] (21 species)
   not a true protein

7. Species Canavalia gladiata [TaxId:3824] [187610] (5 PDB entries)

8. Domain d2d7fl_: 2d7f L: [163603]
   automated match to d1azda_
   complexed with ca, dbb, mma, mn

Details for d2d7fl_

PDB Entry: 2d7f, 2.31 Å

PDB Description: crystal structure of a lectin from canavalia gladiata seeds complexed with alpha-methyl-mannoside and alpha-aminobutyric acid

PDB Compounds: (L:) concanavalin a

SCOPe Domain Sequences for d2d7fl_:

Sequence; same for both SEQRES and ATOM records:

>d2d7fl_ b.29.1.1 (L:) automated matches {Canavalia gladiata [TaxId: 3824]}
adtivaveldtypntdigdpnyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfdatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

Timeline for d2d7fl_:

• d2d7fl_ first appeared in SCOPe 2.01
  
• d2d7fl_ appears in SCOPe 2.04
  
• d2d7fl_ appears in SCOPe 2.06
  
• d2d7fl_ appears in the current release, SCOPe 2.08