Lineage for d2d6pa_ (2d6p A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781176Species Mouse (Mus musculus) [TaxId:10090] [187609] (10 PDB entries)
  8. 2781192Domain d2d6pa_: 2d6p A: [163599]
    automated match to d1a3ka_

Details for d2d6pa_

PDB Entry: 2d6p (more details), 2.7 Å

PDB Description: crystal structure of mouse galectin-9 n-terminal crd in complex with t-antigen
PDB Compounds: (A:) lectin, galactose binding, soluble 9

SCOPe Domain Sequences for d2d6pa_:

Sequence, based on SEQRES records: (download)

>d2d6pa_ b.29.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
alfsaqspyinpiipftgpiqgglqeglqvtlqgttksfaqrfvvnfqnsfngndiafhf
nprfeeggyvvcntkqngqwgpeerkmqmpfqkgmpfelcflvqrsefkvmvnkkffvqy
qhrvpyhlvdtiavsgclklsfitfqtq

Sequence, based on observed residues (ATOM records): (download)

>d2d6pa_ b.29.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
alfsaqspyinpiipftgpiqgglqeglqvtlqgttksfaqrfvvnfqgndiafhfnprf
eeggyvvcntkqngqwgpeerkmqmpfqkgmpfelcflvqrsefkvmvnkkffvqyqhrv
pyhlvdtiavsgclklsfitfqtq

SCOPe Domain Coordinates for d2d6pa_:

Click to download the PDB-style file with coordinates for d2d6pa_.
(The format of our PDB-style files is described here.)

Timeline for d2d6pa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2d6pb_