SCOPe 2.03: Domain d2d6na_: 2d6n A:

Lineage for d2d6na_ (2d6n A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (23 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187609] (10 PDB entries)

8. Domain d2d6na_: 2d6n A: [163596]
   automated match to d1a3ka_

Details for d2d6na_

PDB Entry: 2d6n, 2 Å

PDB Description: crystal structure of mouse galectin-9 n-terminal crd in complex with n-acetyllactosamine

PDB Compounds: (A:) lectin, galactose binding, soluble 9

SCOPe Domain Sequences for d2d6na_:

Sequence; same for both SEQRES and ATOM records:

>d2d6na_ b.29.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gsmalfsaqspyinpiipftgpiqgglqeglqvtlqgttksfaqrfvvnfqnsfngndia
fhfnprfeeggyvvcntkqngqwgpeerkmqmpfqkgmpfelcflvqrsefkvmvnkkff
vqyqhrvpyhlvdtiavsgclklsfitfqtqn

Timeline for d2d6na_:

• d2d6na_ first appeared in SCOPe 2.01
  
• d2d6na_ appears in SCOPe 2.02
  
• d2d6na_ appears in SCOPe 2.04
  
• d2d6na_ appears in the current release, SCOPe 2.08, called d2d6na1