SCOPe 2.08: Domain d2d6mb1: 2d6m B:1-149

Lineage for d2d6mb1 (2d6m B:1-149)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187609] (10 PDB entries)

8. Domain d2d6mb1: 2d6m B:1-149 [163595]
   Other proteins in same PDB: d2d6ma2, d2d6mb2
   automated match to d1a3ka_

Details for d2d6mb1

PDB Entry: 2d6m, 1.6 Å

PDB Description: crystal structure of mouse galectin-9 n-terminal crd in complex with lactose

PDB Compounds: (B:) lectin, galactose binding, soluble 9

SCOPe Domain Sequences for d2d6mb1:

Sequence; same for both SEQRES and ATOM records:

>d2d6mb1 b.29.1.0 (B:1-149) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
malfsaqspyinpiipftgpiqgglqeglqvtlqgttksfaqrfvvnfqnsfngndiafh
fnprfeeggyvvcntkqngqwgpeerkmqmpfqkgmpfelcflvqrsefkvmvnkkffvq
yqhrvpyhlvdtiavsgclklsfitfqtq

Timeline for d2d6mb1:

• d2d6mb1 first appeared in SCOPe 2.01, called d2d6mb_
  
• d2d6mb1 appears in SCOPe 2.07