Lineage for d2d6kb_ (2d6k B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051795Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2051796Protein automated matches [190437] (53 species)
    not a true protein
  7. 2052214Species Mouse (Mus musculus) [TaxId:10090] [187609] (10 PDB entries)
  8. 2052229Domain d2d6kb_: 2d6k B: [163592]
    automated match to d1a3ka_

Details for d2d6kb_

PDB Entry: 2d6k (more details), 2.5 Å

PDB Description: Crystal structure of mouse galectin-9 N-terminal CRD (crystal form 1)
PDB Compounds: (B:) lectin, galactose binding, soluble 9

SCOPe Domain Sequences for d2d6kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d6kb_ b.29.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aqspyinpiipftgpiqgglqeglqvtlqgttksfaqrfvvnfqnsfngndiafhfnprf
eeggyvvcntkqngqwgpeerkmqmpfqkgmpfelcflvqrsefkvmvnkkffvqyqhrv
pyhlvdtiavsgclklsfitfqt

SCOPe Domain Coordinates for d2d6kb_:

Click to download the PDB-style file with coordinates for d2d6kb_.
(The format of our PDB-style files is described here.)

Timeline for d2d6kb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2d6ka_