| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
| Protein automated matches [190437] (70 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [187609] (10 PDB entries) |
| Domain d2d6kb_: 2d6k B: [163592] automated match to d1a3ka_ |
PDB Entry: 2d6k (more details), 2.5 Å
SCOPe Domain Sequences for d2d6kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d6kb_ b.29.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aqspyinpiipftgpiqgglqeglqvtlqgttksfaqrfvvnfqnsfngndiafhfnprf
eeggyvvcntkqngqwgpeerkmqmpfqkgmpfelcflvqrsefkvmvnkkffvqyqhrv
pyhlvdtiavsgclklsfitfqt
Timeline for d2d6kb_: