SCOPe 2.06: Domain d2d5kd1: 2d5k D:3-148

Lineage for d2d5kd1 (2d5k D:3-148)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.0: automated matches [191307] (1 protein)
   not a true family

6. Protein automated matches [190036] (39 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93062] [187608] (1 PDB entry)

8. Domain d2d5kd1: 2d5k D:3-148 [163584]
   Other proteins in same PDB: d2d5ka2, d2d5kb2, d2d5kb3, d2d5kc2, d2d5kd2
   automated match to d1ji5a_
   complexed with gol

Details for d2d5kd1

PDB Entry: 2d5k, 1.85 Å

PDB Description: crystal structure of dps from staphylococcus aureus

PDB Compounds: (D:) Dps family protein

SCOPe Domain Sequences for d2d5kd1:

Sequence; same for both SEQRES and ATOM records:

>d2d5kd1 a.25.1.0 (D:3-148) automated matches {Staphylococcus aureus [TaxId: 93062]}
snqqdvvkelnqqvanwtvaytklhnfhwyvkgpnffslhvkfeelyneasqyvdelaer
ilavggnpvgtltecleqsivkeaakgysaeqmveelsqdftniskqlenaieiagnagd
dvsedmfigmqtsvdkhnwmfksyls

Timeline for d2d5kd1:

• d2d5kd1 first appeared in SCOPe 2.01, called d2d5kd_
  
• d2d5kd1 was called d2d5kd_ in SCOPe 2.05
  
• d2d5kd1 appears in SCOPe 2.07
  
• d2d5kd1 appears in the current release, SCOPe 2.08