Lineage for d2d5kb1 (2d5k B:3-148)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2705117Species Staphylococcus aureus [TaxId:93062] [187608] (1 PDB entry)
  8. 2705119Domain d2d5kb1: 2d5k B:3-148 [163582]
    Other proteins in same PDB: d2d5ka2, d2d5kb2, d2d5kb3, d2d5kc2, d2d5kd2
    automated match to d1ji5a_
    complexed with gol

Details for d2d5kb1

PDB Entry: 2d5k (more details), 1.85 Å

PDB Description: crystal structure of dps from staphylococcus aureus
PDB Compounds: (B:) Dps family protein

SCOPe Domain Sequences for d2d5kb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d5kb1 a.25.1.0 (B:3-148) automated matches {Staphylococcus aureus [TaxId: 93062]}
snqqdvvkelnqqvanwtvaytklhnfhwyvkgpnffslhvkfeelyneasqyvdelaer
ilavggnpvgtltecleqsivkeaakgysaeqmveelsqdftniskqlenaieiagnagd
dvsedmfigmqtsvdkhnwmfksyls

SCOPe Domain Coordinates for d2d5kb1:

Click to download the PDB-style file with coordinates for d2d5kb1.
(The format of our PDB-style files is described here.)

Timeline for d2d5kb1: