SCOP 1.69: Domain d2pdd__: 2pdd -

Lineage for d2pdd__ (2pdd -)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily)
   3 helices; bundle, closed, right-handed twist; up-and-down

4. Superfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (1 family)

5. Family a.9.1.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47006] (3 proteins)

6. Protein E3/E1 binding domain of dihydrolipoyl acetyltransferase [47011] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [47012] (3 PDB entries)

8. Domain d2pdd__: 2pdd - [16358]

Details for d2pdd__

PDB Entry: 2pdd

PDB Description: the high resolution structure of the peripheral subunit-binding domain of dihydrolipoamide acetyltransferase from the pyruvate dehydrogenase multienzyme complex of bacillus stearothermophilus

SCOP Domain Sequences for d2pdd__:

Sequence; same for both SEQRES and ATOM records:

>d2pdd__ a.9.1.1 (-) E3/E1 binding domain of dihydrolipoyl acetyltransferase {Bacillus stearothermophilus}
viampsvrkyarekgvdirlvqgtgkngrvlkedidaflagga

Timeline for d2pdd__:

• d2pdd__ first appeared (with stable ids) in SCOP 1.55
  
• d2pdd__ appears in SCOP 1.67
  
• d2pdd__ appears in SCOP 1.71
  
• d2pdd__ appears in the current release, SCOPe 2.08, called d2pdda_