Lineage for d2pdd__ (2pdd -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1923Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily)
  4. 1924Superfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (1 family) (S)
  5. 1925Family a.9.1.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47006] (3 proteins)
  6. 1933Protein E3/E1 binding domain of dihydrolipoyl acetyltransferase [47011] (1 species)
  7. 1934Species Bacillus stearothermophilus [TaxId:1422] [47012] (2 PDB entries)
  8. 1935Domain d2pdd__: 2pdd - [16358]

Details for d2pdd__

PDB Entry: 2pdd (more details)

PDB Description: the high resolution structure of the peripheral subunit-binding domain of dihydrolipoamide acetyltransferase from the pyruvate dehydrogenase multienzyme complex of bacillus stearothermophilus

SCOP Domain Sequences for d2pdd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pdd__ a.9.1.1 (-) E3/E1 binding domain of dihydrolipoyl acetyltransferase {Bacillus stearothermophilus}
viampsvrkyarekgvdirlvqgtgkngrvlkedidaflagga

SCOP Domain Coordinates for d2pdd__:

Click to download the PDB-style file with coordinates for d2pdd__.
(The format of our PDB-style files is described here.)

Timeline for d2pdd__: