SCOPe 2.05: Domain d2d4va_: 2d4v A:

Lineage for d2d4va_ (2d4v A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
   the active site is between the two identical subunits

6. Protein automated matches [190072] (18 species)
   not a true protein

7. Species Acidithiobacillus thiooxidans [TaxId:930] [187607] (1 PDB entry)

8. Domain d2d4va_: 2d4v A: [163577]
   automated match to d1isoa_
   complexed with flc, nad

Details for d2d4va_

PDB Entry: 2d4v, 1.9 Å

PDB Description: Crystal structure of NAD dependent isocitrate dehydrogenase from Acidithiobacillus thiooxidans

PDB Compounds: (A:) isocitrate dehydrogenase

SCOPe Domain Sequences for d2d4va_:

Sequence; same for both SEQRES and ATOM records:

>d2d4va_ c.77.1.1 (A:) automated matches {Acidithiobacillus thiooxidans [TaxId: 930]}
thiqkpatgspltllngvlqvpdqpiipfiegdgigcdvtpamrsvvdaavakvyggqrq
iawmelfagqkavqlygegqylpdetmaaireykvaikgpletpvgggirslnvamrqdl
dlyvclrpvryfegtpspmrhpekvdmvifrensediyagiewpagspeaekiirflree
mgvtkirfpdssaigikpvstegserlirrtiqyalehgkpsvslvhkgnimkfteggfr
dwgyalaerefagrvftwrqkaaiskaegkaagqkaeqqaiadgkliikdviadnflqqi
llrpedysvvatlnlngdyvsdalaaevggigmapganlsdthaifeathgtapdiagqg
kanpsslilsavmmlehlgwgeaaqaivaamnatiaagevtgdlaalrgdvpalstteft
aalirrf

Timeline for d2d4va_:

• d2d4va_ first appeared in SCOPe 2.01
  
• d2d4va_ appears in SCOPe 2.04
  
• d2d4va_ appears in SCOPe 2.06
  
• d2d4va_ appears in the current release, SCOPe 2.08