SCOPe 2.08: Domain d2d4da1: 2d4d A:1-95

Lineage for d2d4da1 (2d4d A:1-95)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d2d4da1: 2d4d A:1-95 [163576]
   Other proteins in same PDB: d2d4da2
   automated match to d1a9bb_
   complexed with na; mutant

Details for d2d4da1

PDB Entry: 2d4d, 2.1 Å

PDB Description: the crystal structure of human beta2-microglobulin, l39w w60f w95f mutant

PDB Compounds: (A:) Beta-2-microglobulin

SCOPe Domain Sequences for d2d4da1:

Sequence; same for both SEQRES and ATOM records:

>d2d4da1 b.1.1.2 (A:1-95) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdwlkngeriekvehsdlsfskdf
sfyllyyteftptekdeyacrvnhvtlsqpkivkf

Timeline for d2d4da1:

• d2d4da1 first appeared in SCOPe 2.01, called d2d4da_
  
• d2d4da1 appears in SCOPe 2.07