Lineage for d2d3rb_ (2d3r B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778888Protein automated matches [190035] (28 species)
    not a true protein
  7. 2779008Species Cratylia argentea [TaxId:83131] [187602] (2 PDB entries)
  8. 2779014Domain d2d3rb_: 2d3r B: [163572]
    automated match to d1mvqa_
    complexed with ca, mn

Details for d2d3rb_

PDB Entry: 2d3r (more details), 2.9 Å

PDB Description: Cratylia folibunda seed lectin at acidic pH
PDB Compounds: (B:) Lectin alpha chain

SCOPe Domain Sequences for d2d3rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d3rb_ b.29.1.1 (B:) automated matches {Cratylia argentea [TaxId: 83131]}
adtivaveldtypntdigdpnyqhiginiksirskattrwnvqdgkvgtahisynsvakr
lsaivsypggssatvsydvdlnnilpewvrvglsastglyketntilswsftsklktnst
adaqslhftfnqfsqnpkdlilqgdastdsdgnlqltrvsngspqsnsvgralyyapvhv
wdksavvasfdatftflikstdsdiadgiaffiantdssiphgsggrllglfpdan

SCOPe Domain Coordinates for d2d3rb_:

Click to download the PDB-style file with coordinates for d2d3rb_.
(The format of our PDB-style files is described here.)

Timeline for d2d3rb_: