Lineage for d1bal__ (1bal -)
- Root: SCOP 1.71
Class a: All alpha proteins [46456] (226 folds) 
Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily)
3 helices; bundle, closed, right-handed twist; up-and-downSuperfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (1 family) 
Family a.9.1.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47006] (3 proteins) 
Protein E3-binding domain of dihydrolipoamide succinyltransferase [47009] (1 species) Species Escherichia coli [TaxId:562] [47010] (2 PDB entries) 
Domain d1bal__: 1bal - [16357]
Details for d1bal__
PDB Entry: 1bal (more details)
PDB Description: three-dimensional solution structure of the e3-binding domain of the dihydrolipoamide succinyltransferase core from the 2-oxoglutarate dehydrogenase multienzyme complex of (escherichia coli)
SCOP Domain Sequences for d1bal__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bal__ a.9.1.1 (-) E3-binding domain of dihydrolipoamide succinyltransferase {Escherichia coli}
yasleeqnndalspairrllaehnldasaikgtgvggrltredvekhlaka
SCOP Domain Coordinates for d1bal__:
Click to download the PDB-style file with coordinates for d1bal__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bal__:
- d1bal__ first appeared (with stable ids) in SCOP 1.55
- d1bal__ appears in SCOP 1.69
- d1bal__ is called d1bala_ in SCOP 1.73
- d1bal__ appears in the current release, SCOPe 2.08, called d1bala_
View in 3D