Lineage for d1bal__ (1bal -)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 534799Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily)
    3 helices; bundle, closed, right-handed twist; up-and-down
  4. 534800Superfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (1 family) (S)
  5. 534801Family a.9.1.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47006] (3 proteins)
  6. 534805Protein E3-binding domain of dihydrolipoamide succinyltransferase [47009] (1 species)
  7. 534806Species Escherichia coli [TaxId:562] [47010] (2 PDB entries)
  8. 534807Domain d1bal__: 1bal - [16357]

Details for d1bal__

PDB Entry: 1bal (more details)

PDB Description: three-dimensional solution structure of the e3-binding domain of the dihydrolipoamide succinyltransferase core from the 2-oxoglutarate dehydrogenase multienzyme complex of (escherichia coli)

SCOP Domain Sequences for d1bal__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bal__ a.9.1.1 (-) E3-binding domain of dihydrolipoamide succinyltransferase {Escherichia coli}
yasleeqnndalspairrllaehnldasaikgtgvggrltredvekhlaka

SCOP Domain Coordinates for d1bal__:

Click to download the PDB-style file with coordinates for d1bal__.
(The format of our PDB-style files is described here.)

Timeline for d1bal__: