| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.1: Legume lectins [49900] (5 proteins) |
| Protein automated matches [190035] (28 species) not a true protein |
| Species Cratylia argentea [TaxId:83131] [187602] (2 PDB entries) |
| Domain d2d3pc_: 2d3p C: [163569] automated match to d1mvqa_ complexed with ca, mn |
PDB Entry: 2d3p (more details), 2.8 Å
SCOPe Domain Sequences for d2d3pc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d3pc_ b.29.1.1 (C:) automated matches {Cratylia argentea [TaxId: 83131]}
adtivaveldtypntdigdpnyqhiginiksirskattrwnvqdgkvgtahisynsvakr
lsaivsypggssatvsydvdlnnilpewvrvglsastglyketntilswsftsklktnst
adaqslhftfnqfsqnpkdlilqgdastdsdgnlqltrvsngspqsnsvgralyyapvhv
wdksavvasfdatftflikstdsdiadgiaffiantdssiphgsggrllglfpdan
Timeline for d2d3pc_: