![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.131: Peptidyl-tRNA hydrolase II [102461] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 4 strands, order 2143, strand 4 is antiparallel to the rest |
![]() | Superfamily c.131.1: Peptidyl-tRNA hydrolase II [102462] (2 families) ![]() |
![]() | Family c.131.1.0: automated matches [191421] (1 protein) not a true family |
![]() | Protein automated matches [190592] (3 species) not a true protein |
![]() | Species Pyrococcus horikoshii OT3 [TaxId:70601] [187604] (2 PDB entries) |
![]() | Domain d2d3kb_: 2d3k B: [163566] automated match to d1rzwa_ complexed with zn |
PDB Entry: 2d3k (more details), 1.9 Å
SCOPe Domain Sequences for d2d3kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d3kb_ c.131.1.0 (B:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]} mfkykqvivaradlklskgklaaqvahgavtaafeaykkkrewfeawfregqkkvvvkve seeelfklkaeaeklglpnalirdaglteippgtvtvlavgpapeeivdkvtgnlkll
Timeline for d2d3kb_: