Lineage for d2d3kb_ (2d3k B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923056Fold c.131: Peptidyl-tRNA hydrolase II [102461] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 4 strands, order 2143, strand 4 is antiparallel to the rest
  4. 2923057Superfamily c.131.1: Peptidyl-tRNA hydrolase II [102462] (2 families) (S)
  5. 2923077Family c.131.1.0: automated matches [191421] (1 protein)
    not a true family
  6. 2923078Protein automated matches [190592] (3 species)
    not a true protein
  7. 2923094Species Pyrococcus horikoshii OT3 [TaxId:70601] [187604] (2 PDB entries)
  8. 2923097Domain d2d3kb_: 2d3k B: [163566]
    automated match to d1rzwa_
    complexed with zn

Details for d2d3kb_

PDB Entry: 2d3k (more details), 1.9 Å

PDB Description: Structural study on Project ID PH1539 from Pyrococcus horikoshii OT3
PDB Compounds: (B:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d2d3kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d3kb_ c.131.1.0 (B:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
mfkykqvivaradlklskgklaaqvahgavtaafeaykkkrewfeawfregqkkvvvkve
seeelfklkaeaeklglpnalirdaglteippgtvtvlavgpapeeivdkvtgnlkll

SCOPe Domain Coordinates for d2d3kb_:

Click to download the PDB-style file with coordinates for d2d3kb_.
(The format of our PDB-style files is described here.)

Timeline for d2d3kb_: