SCOPe 2.05: Domain d2d3ka_: 2d3k A:

Lineage for d2d3ka_ (2d3k A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.131: Peptidyl-tRNA hydrolase II [102461] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 4 strands, order 2143, strand 4 is antiparallel to the rest

4. Superfamily c.131.1: Peptidyl-tRNA hydrolase II [102462] (2 families)

5. Family c.131.1.0: automated matches [191421] (1 protein)
   not a true family

6. Protein automated matches [190592] (3 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:70601] [187604] (2 PDB entries)

8. Domain d2d3ka_: 2d3k A: [163565]
   automated match to d1rzwa_
   complexed with zn

Details for d2d3ka_

PDB Entry: 2d3k, 1.9 Å

PDB Description: Structural study on Project ID PH1539 from Pyrococcus horikoshii OT3

PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d2d3ka_:

Sequence; same for both SEQRES and ATOM records:

>d2d3ka_ c.131.1.0 (A:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
mfkykqvivaradlklskgklaaqvahgavtaafeaykkkrewfeawfregqkkvvvkve
seeelfklkaeaeklglpnalirdaglteippgtvtvlavgpapeeivdkvtgnlkll

Timeline for d2d3ka_:

• d2d3ka_ first appeared in SCOPe 2.01
  
• d2d3ka_ appears in SCOPe 2.04
  
• d2d3ka_ appears in SCOPe 2.06
  
• d2d3ka_ appears in the current release, SCOPe 2.08