Lineage for d2d2ra_ (2d2r A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490427Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156
  4. 2490428Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families) (S)
    the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase
  5. 2490494Family c.101.1.0: automated matches [191361] (1 protein)
    not a true family
  6. 2490495Protein automated matches [190431] (8 species)
    not a true protein
  7. 2490499Species Helicobacter pylori [TaxId:210] [187325] (2 PDB entries)
  8. 2490500Domain d2d2ra_: 2d2r A: [163563]
    automated match to d1uehb_

Details for d2d2ra_

PDB Entry: 2d2r (more details), 1.88 Å

PDB Description: Crystal structure of Helicobacter pylori Undecaprenyl Pyrophosphate Synthase
PDB Compounds: (A:) undecaprenyl pyrophosphate synthase

SCOPe Domain Sequences for d2d2ra_:

Sequence, based on SEQRES records: (download)

>d2d2ra_ c.101.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 210]}
stlkhlaiimdgngrwaklknkarayghkkgvktlkditiwcanhklecltlyafstenw
krpksevdflmkmlkkylkderstyldnnirfraigdlegfskelrdtilqlendtrhfk
dftqvlalnygsknelsrafksllesppsnisllesleneisnrldtrnlpevdlllrtg
gemrlsnfllwqssyaelfftpilwpdftpkdleniisdfykrvr

Sequence, based on observed residues (ATOM records): (download)

>d2d2ra_ c.101.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 210]}
stlkhlaiimdgngrwaklknkarayghkkgvktlkditiwcanhklecltlyafevdfl
mkmlkkylkderstyldnnirfraigdlegfskelrdtilqlendtrhfkdftqvlalny
gsknelsrafksllesppsnisllesleneisnrldtrnlpevdlllrtggemrlsnfll
wqssyaelfftpilwpdftpkdleniisdfykrvr

SCOPe Domain Coordinates for d2d2ra_:

Click to download the PDB-style file with coordinates for d2d2ra_.
(The format of our PDB-style files is described here.)

Timeline for d2d2ra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2d2rb_