Lineage for d2d2ma_ (2d2m A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 904007Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 904008Protein automated matches [190590] (10 species)
    not a true protein
  7. 904032Species Oligobrachia mashikoi [TaxId:55676] [187601] (4 PDB entries)
  8. 904045Domain d2d2ma_: 2d2m A: [163559]
    automated match to d1x9fb_
    complexed with hem, oxy

Details for d2d2ma_

PDB Entry: 2d2m (more details), 2.85 Å

PDB Description: Structure of an extracellular giant hemoglobin of the gutless beard worm Oligobrachia mashikoi
PDB Compounds: (A:) Giant hemoglobin, A1(b) globin chain

SCOPe Domain Sequences for d2d2ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d2ma_ a.1.1.0 (A:) automated matches {Oligobrachia mashikoi [TaxId: 55676]}
vcnrleqilvktqwaqsygeaenraafsrdlfselfniqgssralfsgvgvddmnsaaft
ahclrvtgalnrlisqldqqatinadlahlagqhasrnldasnfaamgqavmsvvpthld
cfnqhawgecyeriasgisg

SCOPe Domain Coordinates for d2d2ma_:

Click to download the PDB-style file with coordinates for d2d2ma_.
(The format of our PDB-style files is described here.)

Timeline for d2d2ma_: