![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins) |
![]() | Protein automated matches [190384] (21 species) not a true protein |
![]() | Species SARS coronavirus [TaxId:227859] [187411] (13 PDB entries) |
![]() | Domain d2d2da_: 2d2d A: [163557] automated match to d1uj1b_ complexed with enb |
PDB Entry: 2d2d (more details), 2.7 Å
SCOPe Domain Sequences for d2d2da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d2da_ b.47.1.4 (A:) automated matches {SARS coronavirus [TaxId: 227859]} frkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllirks nhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyngsp sgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegkfy gpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynyepl tqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqcsg v
Timeline for d2d2da_: