SCOPe 2.07: Domain d2d1xc1: 2d1x C:1-61

Lineage for d2d1xc1 (2d1x C:1-61)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187598] (102 PDB entries)

8. Domain d2d1xc1: 2d1x C:1-61 [163555]
   Other proteins in same PDB: d2d1xc2
   automated match to d1jo8a_
   complexed with so4

Details for d2d1xc1

PDB Entry: 2d1x, 1.9 Å

PDB Description: The crystal structure of the cortactin-SH3 domain and AMAP1-peptide complex

PDB Compounds: (C:) cortactin isoform a

SCOPe Domain Sequences for d2d1xc1:

Sequence; same for both SEQRES and ATOM records:

>d2d1xc1 b.34.2.0 (C:1-61) automated matches {Human (Homo sapiens) [TaxId: 9606]}
endlgitavalydyqaagddeisfdpddiitniemiddgwwrgvckgryglfpanyvelr
q

Timeline for d2d1xc1:

• d2d1xc1 first appeared in SCOPe 2.01, called d2d1xc_
  
• d2d1xc1 appears in SCOPe 2.06
  
• d2d1xc1 appears in the current release, SCOPe 2.08