Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
Protein automated matches [190457] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187598] (8 PDB entries) |
Domain d2d1xb_: 2d1x B: [163554] automated match to d1jo8a_ complexed with so4 |
PDB Entry: 2d1x (more details), 1.9 Å
SCOPe Domain Sequences for d2d1xb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d1xb_ b.34.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlgitavalydyqaagddeisfdpddiitniemiddgwwrgvckgryglfpanyvelrq
Timeline for d2d1xb_: