Lineage for d1ebdc_ (1ebd C:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 439909Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily)
    3 helices; bundle, closed, right-handed twist; up-and-down
  4. 439910Superfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (1 family) (S)
  5. 439911Family a.9.1.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47006] (3 proteins)
  6. 439912Protein E3-binding domain of dihydrolipoamide acetyltransferase [47007] (1 species)
  7. 439913Species Bacillus stearothermophilus [TaxId:1422] [47008] (1 PDB entry)
  8. 439914Domain d1ebdc_: 1ebd C: [16355]
    Other proteins in same PDB: d1ebda1, d1ebda2, d1ebda3, d1ebdb1, d1ebdb2, d1ebdb3

Details for d1ebdc_

PDB Entry: 1ebd (more details), 2.6 Å

PDB Description: dihydrolipoamide dehydrogenase complexed with the binding domain of the dihydrolipoamide acetylase

SCOP Domain Sequences for d1ebdc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ebdc_ a.9.1.1 (C:) E3-binding domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus}
iampsvrkyarekgvdirlvqgtgkngrvlkedidaflagg

SCOP Domain Coordinates for d1ebdc_:

Click to download the PDB-style file with coordinates for d1ebdc_.
(The format of our PDB-style files is described here.)

Timeline for d1ebdc_: