![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily) 3 helices; bundle, closed, right-handed twist; up-and-down |
![]() | Superfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (2 families) ![]() |
![]() | Family a.9.1.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47006] (4 proteins) |
![]() | Protein E3-binding domain of dihydrolipoamide acetyltransferase [47007] (1 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [47008] (1 PDB entry) |
![]() | Domain d1ebdc_: 1ebd C: [16355] Other proteins in same PDB: d1ebda1, d1ebda2, d1ebda3, d1ebdb1, d1ebdb2, d1ebdb3 complexed with fad |
PDB Entry: 1ebd (more details), 2.6 Å
SCOPe Domain Sequences for d1ebdc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ebdc_ a.9.1.1 (C:) E3-binding domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} iampsvrkyarekgvdirlvqgtgkngrvlkedidaflagg
Timeline for d1ebdc_: