SCOPe 2.08: Domain d1ebdc_: 1ebd C:

Lineage for d1ebdc_ (1ebd C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily)
   3 helices; bundle, closed, right-handed twist; up-and-down

4. Superfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (2 families)

5. Family a.9.1.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47006] (4 proteins)

6. Protein E3-binding domain of dihydrolipoamide acetyltransferase [47007] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [47008] (1 PDB entry)

8. Domain d1ebdc_: 1ebd C: [16355]
   Other proteins in same PDB: d1ebda1, d1ebda2, d1ebda3, d1ebdb1, d1ebdb2, d1ebdb3
   complexed with fad

Details for d1ebdc_

PDB Entry: 1ebd, 2.6 Å

PDB Description: dihydrolipoamide dehydrogenase complexed with the binding domain of the dihydrolipoamide acetylase

PDB Compounds: (C:) dihydrolipoamide acetyltransferase

SCOPe Domain Sequences for d1ebdc_:

Sequence; same for both SEQRES and ATOM records:

>d1ebdc_ a.9.1.1 (C:) E3-binding domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]}
iampsvrkyarekgvdirlvqgtgkngrvlkedidaflagg

Timeline for d1ebdc_:

• d1ebdc_ first appeared (with stable ids) in SCOP 1.55
  
• d1ebdc_ appears in SCOPe 2.07