Lineage for d2d16d_ (2d16 D:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1230603Fold d.256: Ta1353-like [103164] (1 superfamily)
    core: beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 51423;
  4. 1230604Superfamily d.256.1: Ta1353-like [103165] (2 families) (S)
  5. 1230617Family d.256.1.0: automated matches [191419] (1 protein)
    not a true family
  6. 1230618Protein automated matches [190589] (4 species)
    not a true protein
  7. 1230633Species Pyrococcus horikoshii [TaxId:70601] [187599] (1 PDB entry)
  8. 1230637Domain d2d16d_: 2d16 D: [163548]
    automated match to d1vgga_
    complexed with gol, na

Details for d2d16d_

PDB Entry: 2d16 (more details), 1.65 Å

PDB Description: Crystal Structure of PH1918 protein from Pyrococcus horikoshii OT3
PDB Compounds: (D:) hypothetical protein PH1918

SCOPe Domain Sequences for d2d16d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d16d_ d.256.1.0 (D:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
vrievidiekpegveviigqgnfsiftvddlaralltavpgikfgiamneakpqltrytg
ndpelealaaknavkigaghvfvilmknaypinvlntiknhpavamiygasenpfqviva
etelgravigvvdgkaankietdeqkkerrelvekigykid

SCOPe Domain Coordinates for d2d16d_:

Click to download the PDB-style file with coordinates for d2d16d_.
(The format of our PDB-style files is described here.)

Timeline for d2d16d_: