Lineage for d2d16c_ (2d16 C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2614818Fold d.256: Ta1353-like [103164] (1 superfamily)
    core: beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 51423;
  4. 2614819Superfamily d.256.1: Ta1353-like [103165] (2 families) (S)
  5. 2614832Family d.256.1.0: automated matches [191419] (1 protein)
    not a true family
  6. 2614833Protein automated matches [190589] (4 species)
    not a true protein
  7. 2614848Species Pyrococcus horikoshii OT3 [TaxId:70601] [187599] (1 PDB entry)
  8. 2614851Domain d2d16c_: 2d16 C: [163547]
    automated match to d1vgga_
    complexed with gol, na

Details for d2d16c_

PDB Entry: 2d16 (more details), 1.65 Å

PDB Description: Crystal Structure of PH1918 protein from Pyrococcus horikoshii OT3
PDB Compounds: (C:) hypothetical protein PH1918

SCOPe Domain Sequences for d2d16c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d16c_ d.256.1.0 (C:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
mvrievidiekpegveviigqgnfsiftvddlaralltavpgikfgiamneakpqltryt
gndpelealaaknavkigaghvfvilmknaypinvlntiknhpavamiygasenpfqviv
aetelgravigvvdgkaankietdeqkkerrelvekigykid

SCOPe Domain Coordinates for d2d16c_:

Click to download the PDB-style file with coordinates for d2d16c_.
(The format of our PDB-style files is described here.)

Timeline for d2d16c_: