![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.256: Ta1353-like [103164] (1 superfamily) core: beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 51423; |
![]() | Superfamily d.256.1: Ta1353-like [103165] (2 families) ![]() |
![]() | Family d.256.1.0: automated matches [191419] (1 protein) not a true family |
![]() | Protein automated matches [190589] (4 species) not a true protein |
![]() | Species Pyrococcus horikoshii OT3 [TaxId:70601] [187599] (1 PDB entry) |
![]() | Domain d2d16b_: 2d16 B: [163546] automated match to d1vgga_ complexed with gol, na |
PDB Entry: 2d16 (more details), 1.65 Å
SCOPe Domain Sequences for d2d16b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d16b_ d.256.1.0 (B:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]} vrievidiekpegveviigqgnfsiftvddlaralltavpgikfgiamneakpqltrytg ndpelealaaknavkigaghvfvilmknaypinvlntiknhpavamiygasenpfqviva etelgravigvvdgkaankietdeqkkerrelvekigykid
Timeline for d2d16b_: