SCOPe 2.06: Domain d2d16a_: 2d16 A:

Lineage for d2d16a_ (2d16 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.256: Ta1353-like [103164] (1 superfamily)
   core: beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 51423;

4. Superfamily d.256.1: Ta1353-like [103165] (2 families)

5. Family d.256.1.0: automated matches [191419] (1 protein)
   not a true family

6. Protein automated matches [190589] (4 species)
   not a true protein

7. Species Pyrococcus horikoshii OT3 [TaxId:70601] [187599] (1 PDB entry)

8. Domain d2d16a_: 2d16 A: [163545]
   automated match to d1vgga_
   complexed with gol, na

Details for d2d16a_

PDB Entry: 2d16, 1.65 Å

PDB Description: Crystal Structure of PH1918 protein from Pyrococcus horikoshii OT3

PDB Compounds: (A:) hypothetical protein PH1918

SCOPe Domain Sequences for d2d16a_:

Sequence; same for both SEQRES and ATOM records:

>d2d16a_ d.256.1.0 (A:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
mvrievidiekpegveviigqgnfsiftvddlaralltavpgikfgiamneakpqltryt
gndpelealaaknavkigaghvfvilmknaypinvlntiknhpavamiygasenpfqviv
aetelgravigvvdgkaankietdeqkkerrelvekigykid

Timeline for d2d16a_:

• d2d16a_ first appeared in SCOPe 2.01
  
• d2d16a_ appears in SCOPe 2.05
  
• d2d16a_ appears in SCOPe 2.07
  
• d2d16a_ appears in the current release, SCOPe 2.08