Lineage for d2d0wb_ (2d0w B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2691615Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 2691616Protein automated matches [190453] (26 species)
    not a true protein
  7. 2691671Species Hyphomicrobium denitrificans [TaxId:53399] [187593] (1 PDB entry)
  8. 2691673Domain d2d0wb_: 2d0w B: [163544]
    automated match to d2c8sa1
    complexed with hem, zn

Details for d2d0wb_

PDB Entry: 2d0w (more details), 1.98 Å

PDB Description: Crystal structure of cytochrome cL from Hyphomicrobium denitrificans
PDB Compounds: (B:) cytochrome cL

SCOPe Domain Sequences for d2d0wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d0wb_ a.3.1.0 (B:) automated matches {Hyphomicrobium denitrificans [TaxId: 53399]}
aqevfrntvtgealdvegqapkegrdtpavkqfmqtgvdpyvevagclpkgeeiylescs
gchghigegkvgpglndsywtypknttdkglfetifggangmmgphgqdleldnmlklia
wirhiqkddvadadwlsdeqkknfkpfdikaweatgkaaaekaqckis

SCOPe Domain Coordinates for d2d0wb_:

Click to download the PDB-style file with coordinates for d2d0wb_.
(The format of our PDB-style files is described here.)

Timeline for d2d0wb_: