Lineage for d2d0ve_ (2d0v E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016286Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2016349Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family) (S)
    consists of single alpha-helix and irregular N-terminal tail
    automatically mapped to Pfam PF02315
  5. 2016350Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins)
  6. 2016377Protein automated matches [190583] (2 species)
    not a true protein
  7. 2016378Species Hyphomicrobium denitrificans [TaxId:53399] [187590] (1 PDB entry)
  8. 2016380Domain d2d0ve_: 2d0v E: [163540]
    Other proteins in same PDB: d2d0va_, d2d0vd_, d2d0vi_
    automated match to d1h4ib_
    complexed with ca, pqq

Details for d2d0ve_

PDB Entry: 2d0v (more details), 2.49 Å

PDB Description: Crystal structure of methanol dehydrogenase from Hyphomicrobium denitrificans
PDB Compounds: (E:) methanol dehydrogenase small subunit

SCOPe Domain Sequences for d2d0ve_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d0ve_ a.137.2.1 (E:) automated matches {Hyphomicrobium denitrificans [TaxId: 53399]}
ydgthckapgncwepkpgfpekiagskydpkhdpkelnkqvesrkgeeernanraehfkk
tgkwvydv

SCOPe Domain Coordinates for d2d0ve_:

Click to download the PDB-style file with coordinates for d2d0ve_.
(The format of our PDB-style files is described here.)

Timeline for d2d0ve_: