SCOPe 2.08: Domain d2d0ve_: 2d0v E:

Lineage for d2d0ve_ (2d0v E:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family)
   consists of single alpha-helix and irregular N-terminal tail
   automatically mapped to Pfam PF02315

5. Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins)

6. Protein automated matches [190583] (3 species)
   not a true protein

7. Species Hyphomicrobium denitrificans [TaxId:53399] [187590] (1 PDB entry)

8. Domain d2d0ve_: 2d0v E: [163540]
   Other proteins in same PDB: d2d0va_, d2d0vd_, d2d0vi_
   automated match to d1h4ib_
   complexed with ca, pqq

Details for d2d0ve_

PDB Entry: 2d0v, 2.49 Å

PDB Description: Crystal structure of methanol dehydrogenase from Hyphomicrobium denitrificans

PDB Compounds: (E:) methanol dehydrogenase small subunit

SCOPe Domain Sequences for d2d0ve_:

Sequence; same for both SEQRES and ATOM records:

>d2d0ve_ a.137.2.1 (E:) automated matches {Hyphomicrobium denitrificans [TaxId: 53399]}
ydgthckapgncwepkpgfpekiagskydpkhdpkelnkqvesrkgeeernanraehfkk
tgkwvydv

Timeline for d2d0ve_:

• d2d0ve_ first appeared in SCOPe 2.01
  
• d2d0ve_ appears in SCOPe 2.07