![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
![]() | Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) ![]() |
![]() | Family a.8.1.2: GA module, an albumin-binding domain [47001] (4 proteins) Pfam PF01468; also includes FIVAR module, Pfam PF07554 |
![]() | Protein PAB [47002] (1 species) |
![]() | Species Peptostreptococcus magnus [TaxId:1260] [47003] (3 PDB entries) Uniprot Q51911 213-265 |
![]() | Domain d1prba_: 1prb A: [16354] |
PDB Entry: 1prb (more details)
SCOPe Domain Sequences for d1prba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1prba_ a.8.1.2 (A:) PAB {Peptostreptococcus magnus [TaxId: 1260]} tidqwllknakedaiaelkkagitsdfyfnainkaktveevnalkneilkaha
Timeline for d1prba_: