Lineage for d1prb__ (1prb -)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 439808Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (7 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 439809Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (2 families) (S)
  5. 439829Family a.8.1.2: GA module, an albumin-binding domain [47001] (2 proteins)
  6. 439834Protein PAB [47002] (1 species)
  7. 439835Species Peptostreptococcus magnus [TaxId:1260] [47003] (3 PDB entries)
  8. 439838Domain d1prb__: 1prb - [16354]

Details for d1prb__

PDB Entry: 1prb (more details)

PDB Description: structure of an albumin-binding domain, nmr, minimized average structure

SCOP Domain Sequences for d1prb__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1prb__ a.8.1.2 (-) PAB {Peptostreptococcus magnus}
tidqwllknakedaiaelkkagitsdfyfnainkaktveevnalkneilkaha

SCOP Domain Coordinates for d1prb__:

Click to download the PDB-style file with coordinates for d1prb__.
(The format of our PDB-style files is described here.)

Timeline for d1prb__: