Lineage for d1prba_ (1prb A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696962Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2696963Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) (S)
  5. 2697104Family a.8.1.2: GA module, an albumin-binding domain [47001] (4 proteins)
    Pfam PF01468; also includes FIVAR module, Pfam PF07554
  6. 2697119Protein PAB [47002] (1 species)
  7. 2697120Species Peptostreptococcus magnus [TaxId:1260] [47003] (3 PDB entries)
    Uniprot Q51911 213-265
  8. 2697123Domain d1prba_: 1prb A: [16354]

Details for d1prba_

PDB Entry: 1prb (more details)

PDB Description: structure of an albumin-binding domain, nmr, minimized average structure
PDB Compounds: (A:) protein pab

SCOPe Domain Sequences for d1prba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1prba_ a.8.1.2 (A:) PAB {Peptostreptococcus magnus [TaxId: 1260]}
tidqwllknakedaiaelkkagitsdfyfnainkaktveevnalkneilkaha

SCOPe Domain Coordinates for d1prba_:

Click to download the PDB-style file with coordinates for d1prba_.
(The format of our PDB-style files is described here.)

Timeline for d1prba_: