Lineage for d2d0vd_ (2d0v D:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2066579Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 2066580Superfamily b.70.1: Quinoprotein alcohol dehydrogenase-like [50998] (2 families) (S)
  5. 2066581Family b.70.1.1: Quinoprotein alcohol dehydrogenase-like [50999] (4 protein domains)
  6. 2066619Protein automated matches [190582] (2 species)
    not a true protein
  7. 2066620Species Hyphomicrobium denitrificans [TaxId:53399] [187589] (1 PDB entry)
  8. 2066622Domain d2d0vd_: 2d0v D: [163539]
    Other proteins in same PDB: d2d0vb_, d2d0ve_, d2d0vj_
    automated match to d1lrwa_
    complexed with ca, pqq

Details for d2d0vd_

PDB Entry: 2d0v (more details), 2.49 Å

PDB Description: Crystal structure of methanol dehydrogenase from Hyphomicrobium denitrificans
PDB Compounds: (D:) methanol dehydrogenase large subunit

SCOPe Domain Sequences for d2d0vd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d0vd_ b.70.1.1 (D:) automated matches {Hyphomicrobium denitrificans [TaxId: 53399]}
ndklielsnsnenwvmpgknydsnnyststqinvdnvkqlkhawsfstgelhghegaplv
igdvmyvhssfpnktfaldlndpghilwqhspkqdpaarsvaccdlvnrglaywpgddkt
psliiktqldghlvalnaktgeefwkvengdikvgqtltqapyvvhdlaivgssgaelgv
rghvtaynvrtgeqawryyatgpdaeigladdfnsanphygqkglgtatwegdawkiggg
tnwgwyaydpaanliyygsgnpapwnetmrpgdnkwtmtitardadtgkmkfgyqktphd
ewdfagvnvimlseqtdktgkkrkllthpdrngivytldrengdlisadklddtvnvfkt
vdlktglpvrdpeygtrmdhkgtdicpsamgyhnqghdsydpqkqlffmginhicmdwep
fmlpyragqffvgatlwmypgpkgdrqnylglgqikaynaitneykwqhmerfsvwggtl
atagnlvfygtldgflkarnsdtgelvwkhklpsgvigypmtyehkgvqyiavmsgvggw
pgvglvfdlqdptaglgavgafknlqnytqmggslevfsldgknpyddvnvgeyekg

SCOPe Domain Coordinates for d2d0vd_:

Click to download the PDB-style file with coordinates for d2d0vd_.
(The format of our PDB-style files is described here.)

Timeline for d2d0vd_: