![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
![]() | Protein automated matches [190453] (26 species) not a true protein |
![]() | Species Hydrogenophilus thermoluteolus [TaxId:297] [187588] (1 PDB entry) |
![]() | Domain d2d0sa_: 2d0s A: [163536] automated match to d1dvva_ complexed with hec |
PDB Entry: 2d0s (more details), 2.2 Å
SCOPe Domain Sequences for d2d0sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d0sa_ a.3.1.0 (A:) automated matches {Hydrogenophilus thermoluteolus [TaxId: 297]} dealakakgcmachaidkklvgpsykdvakkyteadvpklvekvkkggagvwgpvpmpph pqvaeadiekivrwvltlk
Timeline for d2d0sa_: