Lineage for d2d0jb_ (2d0j B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133441Family c.68.1.7: 1,3-glucuronyltransferase [53467] (3 protein domains)
    automatically mapped to Pfam PF03360
  6. 2133458Protein automated matches [190588] (1 species)
    not a true protein
  7. 2133459Species Human (Homo sapiens) [TaxId:9606] [187596] (1 PDB entry)
  8. 2133461Domain d2d0jb_: 2d0j B: [163531]
    automated match to d1v82b_

Details for d2d0jb_

PDB Entry: 2d0j (more details), 2 Å

PDB Description: Crystal Structure of Human GlcAT-S Apo Form
PDB Compounds: (B:) Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 2

SCOPe Domain Sequences for d2d0jb_:

Sequence, based on SEQRES records: (download)

>d2d0jb_ c.68.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlptiyaitptysrpvqkaeltrlantfrqvaqlhwilvedaaarselvsrflaraglps
thlhvptprrykrpglprateqrnaglawlrqrhqhqraqpgvlffadddntyslelfqe
mrttrkvsvwpvglvggrryerplvengkvvgwytgwradrpfaidmagfavslqvilsn
pkavfkrrgsqpgmqesdflkqittveelepkannctkvlvwhtrtekvnlanepkyhld
tvkiev

Sequence, based on observed residues (ATOM records): (download)

>d2d0jb_ c.68.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlptiyaitptysrpvqkaeltrlantfrqvaqlhwilvedaaarselvsrflaraglps
thlhvptprrglprateqrnaglawlrqrhqhqraqpgvlffadddntyslelfqemrtt
rkvsvwpvglvggrryerplvengkvvgwytgwradrpfaidmagfavslqvilsnpkav
fkrrgsqpgmqesdflkqittveelepkannctkvlvwhtrtekvnlanepkyhldtvki
ev

SCOPe Domain Coordinates for d2d0jb_:

Click to download the PDB-style file with coordinates for d2d0jb_.
(The format of our PDB-style files is described here.)

Timeline for d2d0jb_: