Lineage for d2d0ea1 (2d0e A:4-404)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005432Protein automated matches [190068] (9 species)
    not a true protein
  7. 2005512Species Streptomyces coelicolor [TaxId:100226] [187338] (8 PDB entries)
  8. 2005519Domain d2d0ea1: 2d0e A:4-404 [163529]
    Other proteins in same PDB: d2d0ea2
    automated match to d1s1fa_
    complexed with hem, nq

Details for d2d0ea1

PDB Entry: 2d0e (more details), 2.15 Å

PDB Description: substrate assited in oxygen activation in cytochrome p450 158a2
PDB Compounds: (A:) putative cytochrome P450

SCOPe Domain Sequences for d2d0ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d0ea1 a.104.1.1 (A:4-404) automated matches {Streptomyces coelicolor [TaxId: 100226]}
etisqavppvrdwpavdlpgsdfdpvltelmregpvtrislpngegwawlvtrhddvrlv
tndprfgreavmdrqvtrlaphfipargavgfldppdhtrlrrsvaaaftargvervrer
srgmldelvdamlragppadlteavlspfpiavicelmgvpatdrhsmhtwtqlilsssh
gaevseraknemnayfsdliglrsdsagedvtsllgaavgrdeitlseavglavllqigg
eavtnnsgqmfhlllsrpelaerlrsepeirpraidellrwiphrnavglsrialedvei
kgvriragdavyvsylaanrdpevfpdpdridferspnphvsfgfgphycpggmlarles
ellvdavldrvpglklavapedvpfkkgalirgpealpvtw

SCOPe Domain Coordinates for d2d0ea1:

Click to download the PDB-style file with coordinates for d2d0ea1.
(The format of our PDB-style files is described here.)

Timeline for d2d0ea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2d0ea2